PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g64687.1.p
Common NameBRADI_1g64687, LOC100838726
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 348aa    MW: 37837.7 Da    PI: 4.7271
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g64687.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.66.1e-181461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rgrWT+eEd++l+ +++q+G g+W++ ++  g+ R++k+c++rw +yl
  Bradi1g64687.1.p 14 RGRWTAEEDDILASYIAQHGEGSWRSMPKNAGLLRCGKSCRLRWINYL 61
                      8*******************************99************97 PP

2Myb_DNA-binding53.94e-1767112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg+ + eEd+l+v++++ lG++ W++Ia++++ gRt++++k++w+++l
  Bradi1g64687.1.p  67 RGSISREEDDLIVKLHATLGNR-WSLIASHLP-GRTDNEIKNYWNSHL 112
                       678899****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-22564IPR009057Homeodomain-like
PROSITE profilePS5129416.042961IPR017930Myb domain
SuperFamilySSF466892.1E-2811108IPR009057Homeodomain-like
SMARTSM007171.0E-121363IPR001005SANT/Myb domain
PfamPF002495.5E-161461IPR001005SANT/Myb domain
CDDcd001677.51E-111661No hitNo description
PROSITE profilePS5129425.82562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.2E-2565116IPR009057Homeodomain-like
SMARTSM007173.6E-1766114IPR001005SANT/Myb domain
PfamPF002491.8E-1567112IPR001005SANT/Myb domain
CDDcd001674.46E-1371112No hitNo description
PfamPF066401.5E-31130247IPR010588Myb-related protein P, C-terminal
PfamPF066401.1E-22250347IPR010588Myb-related protein P, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009813Biological Processflavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MGRAPCCEKV GLKRGRWTAE EDDILASYIA QHGEGSWRSM PKNAGLLRCG KSCRLRWINY  60
LRDGVKRGSI SREEDDLIVK LHATLGNRWS LIASHLPGRT DNEIKNYWNS HLSRQIHTFR  120
RTYTAGNDTT ITIDISKLSA AGKRRGGRTA GQSPKSSTKK HPEPETEPNK AKDASSPVTA  180
TSSVSSALQS DEARSAVVDP DQNQPNNSIS GSHTSDGPCS QDETGPFFMD PIDQAGGLLE  240
ANSAMDQFGL WEADSSFNQI GHLEESQMEA LLSNGVAMES GLTGVEPEGQ VQVDDLLDMD  300
WEGFAAHLWN EPAQSDMIQA AEPKTTTTGS DPDELDSFVS WLLSDAC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-23121185110B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00627PBMTransfer from PK06182.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3563341e-156AK356334.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1033F20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003558096.10.0PREDICTED: myb-related protein P-like
SwissprotP278985e-96MYBP_MAIZE; Myb-related protein P
TrEMBLI1H6A70.0I1H6A7_BRADI; Uncharacterized protein
STRINGBRADI1G64687.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.19e-71myb domain protein 12